You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00528
Secondary Accession Numbers None
Name 15-hydroxyprostaglandin dehydrogenase [NAD(+)]
Synonyms Not Available
Gene Name HPGD
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus Not Available
SNPs HPGD
Gene Sequence Not Available
Protein Properties
Number of Residues 266
Molecular Weight 29025.0
Theoretical pI 6.36
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>NAD+ dependent 15-hydroxyprostaglandin dehydrogenase
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVKCKAALDEQFEPQKTLF
IQCDVADQEQLRDTFRKVVDHFGKLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLD
YMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAAMAANLMNSGVRLNA
ICPGFVDTPILKSIEKEENMGKYIEYMGPIKDMMKYYGILDPSMIANGLITLIEDDALNG
AIMKITTSKGIHFQDYDTTPFHMKMQ
GenBank ID Protein ABB18120.1
UniProtKB/Swiss-Prot ID Q309F3
UniProtKB/Swiss-Prot Entry Name Q309F3_BOVIN
PDB IDs Not Available
GenBank Gene ID DQ231564
GeneCard ID HPGD
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available