You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00935
Secondary Accession Numbers None
Name Adenylosuccinate lyase
Synonyms Not Available
Gene Name ADSL
Protein Type Enzyme
Biological Properties
General Function Nucleotide transport and metabolism
Specific Function Catalyzes two non-sequential steps in de novo AMP synthesis: converts (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate (SAICAR) to fumarate plus 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide, and thereby also contributes to de novo IMP synthesis, and converts succinyladenosine monophosphate (SAMP) to AMP and fumarate.
Pathways
  • 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide from 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate: step 2/2
  • AMP biosynthesis via de novo pathway
  • AMP from IMP: step 2/2.
  • Aspartate Metabolism
  • IMP biosynthesis via de novo pathway
  • Purine Metabolism
Reactions
Adenylsuccinic acid → Fumaric acid + Adenosine monophosphate details
SAICAR → Fumaric acid + AICAR details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus Not Available
SNPs ADSL
Gene Sequence
>1473 bp
ATGGCCGCGGCGGGTGACCGTGGCGGGCGGGAGGCGGCCTGCGGGCATGACAGCTACCGT
TCGCCGCTTGCTTCCCGTTATGCTAGCCCGGAGATGTGCTTCCTGTTTAGCGACAAGTAC
AAATTCCGGACCTGGCGGCAGCTCTGGCTGTGGCTGGCGGAGGCCGAGCAGACACTGGGT
TTGCCTATCACAGATGAACAAATCCAGGAGATGAAATCAAACCTGGACAACATTGACTTC
AGGATGGCAGCTGAAGAGGAGAAGCAGTTGCGACATGATGTGATGGCCCACGTGCACACG
TTTGCCCACTGCTGCCCCAAAGCCGCCAGCATTATCCATCTTGGCGCCACCTCCTGCTAT
GTGGGAGACAATACGGACCTGATTATTCTCAGAAATGCATTTGACCTGCTTTTGCCAAAG
CTTGCCAGGGTGATCTCTCGGCTTGCCGACTTTGCCAAGGAACAAGCCGATCTCCCCACC
TTAGGTTTCACACATTTCCAGCCTGCTCAGCTGACCACAGTTGGGAAACGTTGCTGTCTC
TGGATTCAGGATCTGTGCATGGATCTCCAGAACCTGAAGCGTGTCCGGGATGAGCTGCGC
TTCCGAGGCGTGAAGGGTACCACTGGCACCCAGGCCAGCTTCCTGCAGCTCTTCGAAGGA
GATGACCAAAAGGTAGAACAGCTTGACAAGATGGTGACAGAAAAGGCAGGATTCAAGAGG
GCTTTTATCATCACAGGGCAGACCTATACACGAAAAGTAGATATTGAGGTGCTCTCTGTG
CTGGCTAGCTTGGGGGCATCGGTGCACAAGATTTGTACCGACATACGACTCCTGGCAAAC
CTCAAGGAGATGGAGGAGCCCTTTGAAAAACAGCAGATCGGCTCAAGTGCAATGCCATAC
AAGCGGAACCCTATGCGCTCAGAGCGGTGCTGCAGCCTGGCCCGGCACCTGATGGCCCTT
GTCATGGACCCCCTGCAGACGGCATCTGTGCAGTGGTTTGAACGCACACTCGATGACAGT
GCCAACCGACGTATCTGTTTGGCGGAGGCGTTTCTCACTGCAGATACTGTACTGAATACG
TTGCAGAACATTTCTGAAGGATTGGTGGTATACCCCAAAGTCATTGAGCGGCGCGTTCAG
CAGGAGCTGCCTTTCATGGCCACAGAGAACATCATCATGGCCATGGTGAAAGCCGGGGGT
AACCGCCAGGATTGCCGTGAGAAAATCAGAGTGCTCTCGCAGCAGGCAGCTGCCGTGGTC
AAGCAGGAAGGGGGTGACAATGACCTCATCGAGCGCATCCAGGCCGATGCCTACTTCAGT
CCAATCCACTCCCAGCTGGACCATTTGCTGGATCCTTCTTCTTTCACCGGCCGTGCGTCG
CAGCAGGTACAGAGATTCTTAGAAGAGGAGGTGTGTCCCCTGTTAAAACCGTATGAAAGT
GTGATGAAGGTGAAGGCAGAATTACGTCTGTAG
Protein Properties
Number of Residues 490
Molecular Weight 55484.0
Theoretical pI 6.87
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Adenylosuccinate lyase
MAAAGDRGGREAACGHDSYRSPLASRYASPEMCFLFSDKYKFRTWRQLWLWLAEAEQTLG
LPITDEQIQEMKSNLDNIDFRMAAEEEKQLRHDVMAHVHTFAHCCPKAASIIHLGATSCY
VGDNTDLIILRNAFDLLLPKLARVISRLADFAKEQADLPTLGFTHFQPAQLTTVGKRCCL
WIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDDQKVEQLDKMVTEKAGFKR
AFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPY
KRNPMRSERCCSLARHLMALVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTVLNT
LQNISEGLVVYPKVIERRVQQELPFMATENIIMAMVKAGGNRQDCREKIRVLSQQAAAVV
KQEGGDNDLIERIQADAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVCPLLKPYES
VMKVKAELRL
GenBank ID Protein AAI33475.1
UniProtKB/Swiss-Prot ID A3KN12
UniProtKB/Swiss-Prot Entry Name PUR8_BOVIN
PDB IDs Not Available
GenBank Gene ID BC133474
GeneCard ID ADSL
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available