You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01240
Secondary Accession Numbers None
Name Biotinidase
Synonyms Not Available
Gene Name BTD
Protein Type Enzyme
Biological Properties
General Function Involved in biotinidase activity
Specific Function Catalytic release of biotin from biocytin, the product of biotin-dependent carboxylases degradation.
Pathways
  • Biotin Metabolism
Reactions
Biocytin + Water → Biotin + L-Lysine details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus Not Available
SNPs BTD
Gene Sequence
>1578 bp
ATGTCCAGAGCCGGCCGGCAGCTGGCCCTTCTCCTGTGCAGCTGCTGCGTGGCTGTGGCC
ATCCCGGGGGGCCTGGCCGAGGAGGGCTGTCCGGCTGAGCCCCACCAGGCCTCCCGCTAC
GTGGCCGCTGTGTACGAGCACCAATCCTTCCTGAGTCCCGACCCACTGGCCCTCACCAGC
CGCGAGCAAGCCTTGGAGCTCATGCATCGGAACCTCGACGTCTACGAGCAGCAAGTGACA
ACTGCGGCCCGAAAGGGTGCACAGATCATAGTGTTTCCAGAAGACGGCATCCACGGATTC
AACTTTACAAGGACATCCATTTACCCGTTCTTGGACTTCATGCCATCTCCCCGCTCAGTC
AGGTGGAACCCGTGCCTGGAGCCCCACCGCTTCAATGACACGGAGGTCCTCCAGCGCCTG
AGTTGCATGGCTATGAAGGGAGAGATGTTCCTGGTGGCCAATCTTGGGACAAAGCAGCCT
TGCCATAGCAGTGACCCAGGGTGCCCGAGTGACGGTAGATACCAGTTTAACACGAACGTT
GTGTTCAGCAGTAATGGAACCCTGGTTGACCGCTACCGCAAACACAACCTCTATTTTGAG
GCAGCGTTCGATACCCCTCTGGAGGTGGATCACACAGTCTTCGACACCCCCTTCGCTGGC
AAGTTCGGCGTCTTCACTTGCTTTGACATATTGTTCTTTGACCCTGCCGTTAGGCTCCTC
CAGGACTCCGAGGTGAAGCACGTTGTGTATCCGACTGCCTGGATGAACCAGCTGCCACTC
TTGGCAGCCATTCAGATTCAGAGAGGTTTTGCCATCGCCTTTGTCATCAACCTTCTGGCT
GCGAACATCCACCACCCATCTCTGGGGATGACGGGGAGTGGCATACACACCCCTCTGAAG
TCCTTTTGGCACCACAGCATGGACAGCCCTGAAGGCCACCTCATAATTGCTGAGGTGGCC
AGAAACCCACCGGGCCTCATCAGTGCAGGGAACGCCACAGGGAAAACGGACCCATTCCAC
AGGAAGTTTTTACAACTCTTGGCAGGGGATCCCTACTCAGAGAAGGATGCCCAGGACGTC
CATTGTGATGCGGCCCCCAAATCAACCACGAATGCCTCTCCCACGTTTAACTCTGAGATG
ATGTATGACAATTTCACCCTGGTTCCCGTGTGGGGAAGGGACGGCCACGTCCACGTCTGT
GCACACGGCCTCTGCTGTCATCTGCTTTACCAGAGGCCCACCGTGTCCCAGGAGCTGTAT
GCCCTGGGGGTCTTCGATGGTCTTCACACCGTGCACGGCACCTACTATGTCCAAGTCTGT
GCCCTGGTCAAGTGTGGGGGTCTTGGCTTTGACACGTGTGGGCAGGAGATCACAGAGGCC
ATGGGGATGTTCGAGTTTCACCTGTGGGGGAACTTCAGTACTTCTTATATCTTCCCAATG
CTTCTGACCTCAGGGATGATGCTGGAAACCCCTGACCAGCTGGGCTGGGAGAGTGATCAG
TATTTCCTGAAGAAGAGGGGACTGTCCTCTGGGCTGGTGACGGCAGCTCTCTACGGGCGG
TTATATGAGAGGGACTAG
Protein Properties
Number of Residues 525
Molecular Weight 58353.0
Theoretical pI 6.29
Pfam Domain Function Not Available
Signals
  • 1-26
Transmembrane Regions Not Available
Protein Sequence
>Biotinidase
MSRAGRQLALLLCSCCVAVAIPGGLAEEGCPAEPHQASRYVAAVYEHQSFLSPDPLALTS
REQALELMHRNLDVYEQQVTTAARKGAQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPRSV
RWNPCLEPHRFNDTEVLQRLSCMAMKGEMFLVANLGTKQPCHSSDPGCPSDGRYQFNTNV
VFSSNGTLVDRYRKHNLYFEAAFDTPLEVDHTVFDTPFAGKFGVFTCFDILFFDPAVRLL
QDSEVKHVVYPTAWMNQLPLLAAIQIQRGFAIAFVINLLAANIHHPSLGMTGSGIHTPLK
SFWHHSMDSPEGHLIIAEVARNPPGLISAGNATGKTDPFHRKFLQLLAGDPYSEKDAQDV
HCDAAPKSTTNASPTFNSEMMYDNFTLVPVWGRDGHVHVCAHGLCCHLLYQRPTVSQELY
ALGVFDGLHTVHGTYYVQVCALVKCGGLGFDTCGQEITEAMGMFEFHLWGNFSTSYIFPM
LLTSGMMLETPDQLGWESDQYFLKKRGLSSGLVTAALYGRLYERD
GenBank ID Protein AAI49585.1
UniProtKB/Swiss-Prot ID A6QQ07
UniProtKB/Swiss-Prot Entry Name BTD_BOVIN
PDB IDs Not Available
GenBank Gene ID BC149584
GeneCard ID BTD
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available