| Identification |
| BMDB Protein ID
| BMDBP00143 |
| Secondary Accession Numbers
| None |
| Name
| Insulin-like growth factor 1 receptor |
| Synonyms
|
Not Available
|
| Gene Name
| IGF1R |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in ATP binding |
| Specific Function
| Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT/PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase/signal transducer and activator of transcription pathway (JAK/STAT). Phosphorylation of JAK proteins can lead to phosphorylation/activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK/STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5/ASK1, which is able to directly associate with the IGF1R (By similarity). When present in a hybrid receptor with INSR, binds IGF1 (By similarity). |
| Pathways
|
- CXCR4 Signaling Pathway
- GnRH Signaling Pathway
- Growth Hormone Signaling Pathway
- Insulin Signalling
- Ion Channel and Phorbal Esters Signaling Pathway
- Leucine Stimulation on Insulin Signaling
|
| Reactions
|
| Insulin receptor substrate 1 → Insulin receptor substrate 1 with Phosphorylation |
details
|
| Insulin receptor substrate 2 → Insulin receptor substrate 2 with Phosphorylation |
details
|
| SHC-transforming protein 1 → SHC-transforming protein 1 with phosphorylation |
details
|
|
| GO Classification
|
Not Available
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 21 |
| Locus
| Not Available |
| SNPs
| IGF1R |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| 640 |
| Molecular Weight
| 72511.0 |
| Theoretical pI
| 5.08 |
| Pfam Domain Function
|
Not Available |
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Insulin-like growth factor 1 receptor
NAIFVPRPERKRREVMQIANTTMSSRSRNTTVLDTYNITDPEELETEYPFFESRVDNKER
TVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENS
IFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQA
TSLSGNGSWTDPVFFYVQAKTTYENFIHLMIALPIAVLLIVGGLVIMLYVFHRKRNSSRL
GNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPE
TRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDL
KSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDF
TVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIAT
LAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSVK
DEMEAGFREVSFYYSEENKPPEPEELDLEPENMESVPLDPSASSASLPLPDRHSGHKAEN
GPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
|
| External Links |
| GenBank ID Protein
| CAA38724.1 |
| UniProtKB/Swiss-Prot ID
| Q05688 |
| UniProtKB/Swiss-Prot Entry Name
| IGF1R_BOVIN |
| PDB IDs
|
|
| GenBank Gene ID
| X54980 |
| GeneCard ID
| IGF1R |
| GenAtlas ID
| Not Available |
| HGNC ID
| Not Available |
| References |
| General References
| Not Available |