Showing Protein Superoxide dismutase [Mn], mitochondrial (BMDBP00586)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00586 |
| Secondary Accession Numbers | None |
| Name | Superoxide dismutase [Mn], mitochondrial |
| Synonyms | Not Available |
| Gene Name | SOD2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Inorganic ion transport and metabolism |
| Specific Function | Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 9 |
| Locus | Not Available |
| SNPs | SOD2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 222 |
| Molecular Weight | 24638.0 |
| Theoretical pI | 8.76 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Superoxide dismutase [Mn], mitochondrial MLSRAACSTSRRLVPALSVLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN NLNVAEEKYREALEKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPQGELLEA IKRDFGSFAKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTARYTACSK |
| External Links | |
| GenBank ID Protein | AAA30655.1 |
| UniProtKB/Swiss-Prot ID | P41976 |
| UniProtKB/Swiss-Prot Entry Name | SODM_BOVIN |
| PDB IDs | |
| GenBank Gene ID | L22092 |
| GeneCard ID | SOD2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |