Showing Protein Similar to oligomycin-sensitivity conferral protein (BMDBP00735)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00735 |
| Secondary Accession Numbers | None |
| Name | Similar to oligomycin-sensitivity conferral protein |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 1 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 125 |
| Molecular Weight | 14150.0 |
| Theoretical pI | 10.19 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>ATP synthase VRPFAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLN PYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFYYHDECPPWRST MHSYH |
| External Links | |
| GenBank ID Protein | BAC56570.1 |
| UniProtKB/Swiss-Prot ID | Q862C2 |
| UniProtKB/Swiss-Prot Entry Name | Q862C2_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AB099080 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |