1.0 2018-05-07 22:23:49 UTC 2020-05-20 21:52:38 UTC BMDBP00748 Enzyme ATP5MG Involved in hydrogen ion transmembrane transporter acti Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane. BMDB0001362 Hydrogen 15 >315 bp ATGGCCGAGTTTGTCCGTAACCTCGCGGAAAAGGCCCCGGCGCTGGTCAACGCTGCTGTG ACTTACTCGAAGCCTCGATTGGCCACGTTTTGGTACTATGCCAAGGTTGAGCTGGTTCCT CCAACCCCTGCTGAGATCCCTACAGCAATTCAGAGCTTGAAAAAAATTATCAACAGTGCT AAAACCGGTAGCTTCAAACAGCTCACTGTTAAGGAAGCTCTACTGAATGGTTTGGTGGCC ACTGAGGTGTGGATGTGGTTTTATGTTGGCGAGATCATAGGCAAGCGTGGCATCATTGGC TATGATGTTTGAAGA 103 11417.0 9.92 6-31 67-86 98-117 137-158 164-184 196-222 None >ATP synthase subunit g, mitochondrial MAEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSA KTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV AAB31108.3 Q28852 ATP5L_BOVIN S70448 ATP5MG