| Identification |
|---|
| BMDB Protein ID
| BMDBP00753 |
| Secondary Accession Numbers
| None |
| Name
| ATP synthase subunit e, mitochondrial |
| Synonyms
|
Not Available
|
| Gene Name
| ATP5ME |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in hydrogen ion transmembrane transporter acti |
| Specific Function
| Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane. |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
Not Available
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 6 |
| Locus
| Not Available |
| SNPs
| ATP5ME |
| Gene Sequence
|
>216 bp
ATGGTTCCGCCGGTGCAGGTCTCTCCGCTCATCAAGCTCGGCCGTTACTCCGCCCTGTTC
CTCGGCATGGCCTACGGCGCCAAGCGCTACAATTACCTGAAACCTCGGGCAGAAGAGGAG
AGGAGGCTTGCAGCCGAGGAGAAGAAGAAGCGGGATGAGCAGAAGCGCATCGAGCGGGAG
CTGGCGGAAGCCCAAGAGGATACCATATTGAAGTGA
|
| Protein Properties |
|---|
| Number of Residues
| 71 |
| Molecular Weight
| 8321.0 |
| Theoretical pI
| 10.03 |
| Pfam Domain Function
|
Not Available |
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>ATP synthase subunit e, mitochondrial
MVPPVQVSPLIKLGRYSALFLGMAYGAKRYNYLKPRAEEERRLAAEEKKKRDEQKRIERE
LAEAQEDTILK
|
| External Links |
|---|
| GenBank ID Protein
| AAA30390.1 |
| UniProtKB/Swiss-Prot ID
| Q00361 |
| UniProtKB/Swiss-Prot Entry Name
| ATP5I_BOVIN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| M64751 |
| GeneCard ID
| ATP5ME |
| GenAtlas ID
| Not Available |
| HGNC ID
| Not Available |
| References |
|---|
| General References
| Not Available |
