1.0 2018-05-07 22:24:50 UTC 2020-05-20 21:52:38 UTC BMDBP00970 Enzyme UBE2N Involved in ATP binding The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UB2V1, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIG-I/DDX58 to activate the downstream signaling pathway that leads to interferon beta production (By similarity). Protein modification Protein ubiquitination BMDB0000182 L-Lysine 5 >459 bp ATGGCCGGGCTGCCCCGCAGGATTATCAAGGAAACCCAGCGTTTGCTGGCAGAACCAGTT CCCGGCATTAAAGCAGAACCAGATGAGAGCAACGCCCGTTATTTTCATGTGGTCATTGCC GGCCCTCAGGATTCCCCCTTTGAGGGAGGGACTTTTAAACTTGAACTATTCCTTCCAGAA GAATACCCAATGGCAGCCCCTAAAGTACGTTTCATGACCAAAATTTATCATCCTAATGTA GACAAGTTGGGAAGAATATGTTTAGATATTTTGAAAGATAAGTGGTCCCCAGCACTGCAG ATCCGCACAGTTCTGCTATCGATCCAGGCTTTGTTAAGTGCTCCCAATCCAGATGATCCA TTAGCAAATGATGTAGCGGAGCAATGGAAGACCAATGAAGCCCAAGCCATAGAAACAGCT AGAGCATGGACTAGGCTATATGCCATGAATAATATTTAA 152 17138.0 6.53 4-24 182-202 271-291 None >Ubiquitin-conjugating enzyme E2 N MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP LANDVAEQWKTNEAQAIETARAWTRLYAMNNI AAI19932.1 Q0P5K3 UBE2N_BOVIN 1J7D BC119931 UBE2N