1.0 2018-05-07 22:24:52 UTC 2020-05-20 21:52:38 UTC BMDBP00977 Enzyme UBE2B Involved in ATP binding Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In association with the E3 enzyme BRE1 (RNF20 and/or RNF40), it plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B at 'Lys-120' to form H2BK120ub1. H2BK120ub1 gives a specific tag for epigenetic transcriptional activation, elongation by RNA polymerase II, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'- and 'Lys-63'-linked polyubiquitination. Required for postreplication repair of UV-damaged DNA. Associates to the E3 ligase RAD18 to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. May be involved in neurite outgrowth. Protein modification Protein ubiquitination BMDB0000182 L-Lysine 7 >459 bp ATGTCGACCCCGGCCCGGAGGAGGCTTATGCGGGATTTCAAGCGATTGCAAGAGGACCCA CCTGTGGGTGTCAGTGGCGCACCATCTGAAAACAACATCATGCAGTGGAATGCAGTTATA TTTGGACCAGAAGGGACACCCTTTGAAGATGGAACTTTTAAACTAGTAATAGAATTTTCT GAAGAATATCCAAATAAGCCGCCAACTGTTAGGTTTTTATCCAAAATGTTTCATCCAAAT GTGTATGCTGATGGTAGCATATGTTTAGATATCCTTCAGAATAGATGGAGTCCAACATAC GATGTATCTTCTATCTTAACATCAATTCAGTCTCTGCTGGATGAACCGAATCCAAATAGT CCAGCCAATAGTCAGGCAGCACAGCTTTATCAGGAAAACAAACGAGAATATGAGAAAAGA GTTTCGGCCATTGTTGAACAAAGCTGGAATGATTCATAA 152 17312.0 4.64 471-493 574-592 None >Ubiquitin-conjugating enzyme E2 B MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS PANSQAAQLYQENKREYEKRVSAIVEQSWNDS AAI08203.1 Q32P99 UBE2B_BOVIN 1JAS BC108202 UBE2B