1.0 2018-05-07 22:24:55 UTC 2020-05-20 21:05:18 UTC BMDBP00986 Enzyme ALDH3A1 Energy production and conversion ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde (Probable). They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation (Probable). Oxidizes medium and long chain aldehydes into non-toxic fatty acids (By similarity). Preferentially oxidizes aromatic aldehyde substrates (By similarity). Comprises about 50 percent of corneal epithelial soluble proteins (By similarity). May play a role in preventing corneal damage caused by ultraviolet light (By similarity). BMDB0000217 NADP BMDB0000902 NAD BMDB0000990 Acetaldehyde 19 239 26743.0 8.35 None >Aldehyde dehydrogenase, dimeric NADP-preferring NPHYVDKDRDLDIACRRIAWGKFMNSGQTCVAPDYILCDPSIQSQVVEKLKKSLKEFYGE DAKKSRDYGRIINSRHFQRVMGLLEGQKVAYGGTGDATTRYIAPTILTDVDPESPVMQEE VFGPVLPIMCVRSLEEAIQFITQREKPLALYVFSPNDKVIKKMIAETSSGGVTANDVVVH ISVHSLPYGGVGDSGMGSYHGRKSFETFSHRRSCLVRPLLNEETLKARYPRARPICPDT AAB24736.2 P30907 AL3A1_BOVIN S51969 ALDH3A1