Showing Protein Glyceraldehyde phosphate dehydrogenase (BMDBP01094)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01094 |
| Secondary Accession Numbers | None |
| Name | Glyceraldehyde phosphate dehydrogenase |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Carbohydrate transport and metabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 5 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 57 |
| Molecular Weight | 6031.0 |
| Theoretical pI | 9.16 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Glyceraldehyde phosphate dehydrogenase LVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISA |
| External Links | |
| GenBank ID Protein | AAO45613.2 |
| UniProtKB/Swiss-Prot ID | Q865L2 |
| UniProtKB/Swiss-Prot Entry Name | Q865L2_BOVIN |
| PDB IDs | |
| GenBank Gene ID | AY197340 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |