Showing Protein Retinol dehydrogenase 12 (BMDBP01288)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| BMDB Protein ID | BMDBP01288 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Retinol dehydrogenase 12 | ||||||||
| Synonyms | Not Available | ||||||||
| Gene Name | RDH12 | ||||||||
| Protein Type | Enzyme | ||||||||
| Biological Properties | |||||||||
| General Function | Lipid transport and metabolism | ||||||||
| Specific Function | Retinoids dehydrogenase/reductase with a clear preference for NADP. Displays high activity towards 9-cis, 11-cis and all-trans-retinal. Shows very weak activity towards 13-cis-retinol. Also exhibits activity, albeit with lower affinity than for retinaldehydes, towards lipid peroxidation products (C9 aldehydes) such as 4-hydroxynonenal and trans-2-nonenal. May play an important function in photoreceptor cells to detoxify 4-hydroxynonenal and potentially other toxic aldehyde products resulting from lipid peroxidation. Has no dehydrogenase activity towards steroids. | ||||||||
| Pathways |
|
||||||||
| Reactions |
|
||||||||
| GO Classification | Not Available | ||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 10 | ||||||||
| Locus | Not Available | ||||||||
| SNPs | RDH12 | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | 316 | ||||||||
| Molecular Weight | 35171.0 | ||||||||
| Theoretical pI | 10.15 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals |
|
||||||||
| Transmembrane Regions |
|
||||||||
| Protein Sequence |
>Retinol dehydrogenase 12 MLVVLGLLTSFLSFLYVIAPSIRKFFAGGVCRTDVQLFGKVVVITGANTGIGKETARELA RRGARVYIACRDVLKGESAASEIQADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLH ILINNAGVMLCPYSKTADGFETHLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVAHHL GKIRFHDLQGDKYYNLGFAYCHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKLVRH SFLLCLLWRLFSPFLKTTWEGAQTSLHCALAEGLEPLSGKYFSDCKKTWVSPRARNNKTA ERLWNVSCELLGIRWE |
||||||||
| External Links | |||||||||
| GenBank ID Protein | AAM51556.1 | ||||||||
| UniProtKB/Swiss-Prot ID | P59837 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | RDH12_BOVIN | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | AY115489 | ||||||||
| GeneCard ID | RDH12 | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | Not Available | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||