Identification
BMDB Protein ID BMDBP01417
Secondary Accession Numbers None
Name Similar to connective tissue growth factor
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in heparin binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus Not Available
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 125
Molecular Weight 14352.0
Theoretical pI 8.72
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Similar to connective tissue growth factor
NAFCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFC
GVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKSMMFIKTCACHYNCPGDNDIFESLYYRKM
YGDMA
GenBank ID Protein BAC56387.1
UniProtKB/Swiss-Prot ID Q862T0
UniProtKB/Swiss-Prot Entry Name Q862T0_BOVIN
PDB IDs Not Available
GenBank Gene ID AB098897
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available