Showing Protein Cytochrome b (BMDBP01539)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01539 |
| Secondary Accession Numbers | None |
| Name | Cytochrome b |
| Synonyms | Not Available |
| Gene Name | cytb |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | cytb |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 119 |
| Molecular Weight | 13403.0 |
| Theoretical pI | 6.79 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Cytochrome b RGLYYGSYTFLETWNIGVILLLTVMATAFMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXTLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKI |
| External Links | |
| GenBank ID Protein | ACL93213.1 |
| UniProtKB/Swiss-Prot ID | B8XJW1 |
| UniProtKB/Swiss-Prot Entry Name | B8XJW1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | FJ392896 |
| GeneCard ID | cytb |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |