Showing Protein Gamma-aminobutyric acid receptor subunit beta-2 (BMDBP01836)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01836 |
| Secondary Accession Numbers | None |
| Name | Gamma-aminobutyric acid receptor subunit beta-2 |
| Synonyms | Not Available |
| Gene Name | GABRB2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in chloride channel activity |
| Specific Function | Ligand-gated chloride channel which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain (PubMed:2548852). Plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel (By similarity). The gamma2 subunit is necessary but not sufficient for a rapid formation of active synaptic contacts and the synaptogenic effect of this subunit is influenced by the type of alpha and beta subunits present in the receptor pentamer (By similarity). The alpha1/beta2/gamma2 receptor and the alpha2/beta2/gamma2 receptor exhibit synaptogenic activity (By similarity). Functions also as histamine receptor and mediates cellular responses to histamine (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | GABRB2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 472 |
| Molecular Weight | 54451.0 |
| Theoretical pI | 9.44 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Gamma-aminobutyric acid receptor subunit beta-2 RVRKKDYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAV GMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTTACMMDLRRYPLDEQNCTLEIESYG YTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNI GYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYV KAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKMDP HENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFWRNALERHV AQKKSRLRERASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | P0C2W5 |
| UniProtKB/Swiss-Prot Entry Name | GBRB2_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | Not Available |
| GeneCard ID | GABRB2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |