Showing Protein Phospholemman (BMDBP01872)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01872 |
| Secondary Accession Numbers | None |
| Name | Phospholemman |
| Synonyms | Not Available |
| Gene Name | FXYD1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in chloride channel activity |
| Specific Function | Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na(+) out of the cell and K(+) into the cell (PubMed:12657675). Inhibits NKA activity in its unphosphorylated state and stimulates activity when phosphorylated (By similarity). Reduces glutathionylation of the NKA beta-1 subunit ATP1B1, thus reversing glutathionylation-mediated inhibition of ATP1B1 (By similarity). Contributes to female sexual development by maintaining the excitability of neurons which secrete gonadotropin-releasing hormone (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 18 |
| Locus | Not Available |
| SNPs | FXYD1 |
| Gene Sequence |
>279 bp ATGGCATCTCTCAGCCACATCTTGGTTCTTTGTGTGGGTCTCCTTGCCATGGTCAACGCA GAAGCACCACAGGAACACGACCCATTCACCTACGACTACCAATCCCTGCGGATCGGAGGC CTTATAATCGCCGGGATTCTCTTCATCCTGGGCATACTCATCGTCTTAAGCAGAAGATGC CGGTGCAAATTCAACCAGCAGCAGAGGACTGGGGAACCTGATGAAGAGGAGGGAACTTTC CGCAGTTCAATCCGCCGTCTGTCCACCCGCCGGCGGTAG |
| Protein Properties | |
| Number of Residues | 92 |
| Molecular Weight | 10447.0 |
| Theoretical pI | 8.93 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Phospholemman MASLSHILVLCVGLLAMVNAEAPQEHDPFTYDYQSLRIGGLIIAGILFILGILIVLSRRC RCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR |
| External Links | |
| GenBank ID Protein | AAI02672.1 |
| UniProtKB/Swiss-Prot ID | Q3SZX0 |
| UniProtKB/Swiss-Prot Entry Name | PLM_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | BC102671 |
| GeneCard ID | FXYD1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |