| Identification |
| BMDB Protein ID
| BMDBP01898 |
| Secondary Accession Numbers
| None |
| Name
| Basigin |
| Synonyms
|
Not Available
|
| Gene Name
| BSG |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in mannose binding |
| Specific Function
| Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3, SLC16A8, SLC16A11 and SLC16A12 to the plasma membrane. Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes. |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
Not Available
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| BSG |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| 205 |
| Molecular Weight
| 22119.0 |
| Theoretical pI
| 5.06 |
| Pfam Domain Function
|
Not Available |
| Signals
|
|
|
Transmembrane Regions
|
- 243-266
- 270-292
- 305-327
- 417-438
|
| Protein Sequence
|
>Basigin
MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGV
VLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGE
TAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADP
GQYRCNGTSSKGSDQAIITLRVRSH
|
| External Links |
| GenBank ID Protein
| BAC67167.1 |
| UniProtKB/Swiss-Prot ID
| Q865R3 |
| UniProtKB/Swiss-Prot Entry Name
| BASI_BOVIN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AB091679 |
| GeneCard ID
| BSG |
| GenAtlas ID
| Not Available |
| HGNC ID
| Not Available |
| References |
| General References
| Not Available |