Showing Protein Adrenodoxin, mitochondrial (BMDBP01947)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01947 |
| Secondary Accession Numbers | None |
| Name | Adrenodoxin, mitochondrial |
| Synonyms | Not Available |
| Gene Name | FDX1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 15 |
| Locus | Not Available |
| SNPs | FDX1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 186 |
| Molecular Weight | 19756.0 |
| Theoretical pI | 5.3 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Adrenodoxin, mitochondrial MAARLLRVASAALGDTAGRWRLLARPRAGAGGLRGSRGPGLGGGAVATRTLSVSGRAQSS SEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQH IFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGM NSSKIE |
| External Links | |
| GenBank ID Protein | AAA30357.1 |
| UniProtKB/Swiss-Prot ID | P00257 |
| UniProtKB/Swiss-Prot Entry Name | ADX_BOVIN |
| PDB IDs | |
| GenBank Gene ID | M11746 |
| GeneCard ID | FDX1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |