1.0 2018-05-07 22:29:23 UTC 2020-05-20 21:52:41 UTC BMDBP01960 Enzyme FOLR1 Involved in folic acid binding Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation (By similarity). BMDB0000121 Folic acid 15 241 27922.0 7.89 61-81 88-108 139-159 231-251 270-290 305-325 342-362 395-415 445-465 480-500 521-541 561-581 1-19 >Folate receptor alpha MAWQMTQLLLLALVAAAWGAQAPRTPRARTDLLNVCMDAKHHKAEPGPEDSLHEQCSPWR KNACCSVNTSIEAHKDISYLYRFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIREVN QRWRKERVLGVPLCKEDCQSWWEDCRTSYTCKSNWHKGWNWTSGYNQCPVKAAHCRFDFY FPTPAALCNEIWSHSYKVSNYSRGSGRCIQMWFDPFQGNPNEEVARFYAENPTSGSTPQG I P02702 FOLR1_BOVIN DN512948 FOLR1