Showing Protein V-type proton ATPase subunit G (BMDBP01976)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01976 |
| Secondary Accession Numbers | None |
| Name | V-type proton ATPase subunit G |
| Synonyms | Not Available |
| Gene Name | ATP6V1G2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in hydrogen-exporting ATPase activity, phospho |
| Specific Function | Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 23 |
| Locus | Not Available |
| SNPs | ATP6V1G2 |
| Gene Sequence |
>192 bp ATGGCCAGTCAATCCCAGGGTATCCAGCAGCTCCTGCAAGCCGAGAAGCGGGCGGCTGAG AAGGTGGCAGATGCCAGAAAGAGGAAGGCTCGGCGTCTGAAGCAGGCAAAGGAGGAGGCA CAAATGGAAGTGGATCAGTACCGCAGAGAGAGAGAGCAAGAATTCCAGAGCAAGCAGCAG GCAACCTTATGA |
| Protein Properties | |
| Number of Residues | 63 |
| Molecular Weight | 7432.0 |
| Theoretical pI | 10.7 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>ATP6V1G2 protein MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVDQYRREREQEFQSKQQ ATL |
| External Links | |
| GenBank ID Protein | AAI11676.1 |
| UniProtKB/Swiss-Prot ID | Q2NKS1 |
| UniProtKB/Swiss-Prot Entry Name | Q2NKS1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | BC111675 |
| GeneCard ID | ATP6V1G2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |