Showing Protein Natriuretic peptides B (BMDBP01980)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01980 |
| Secondary Accession Numbers | None |
| Name | Natriuretic peptides B |
| Synonyms | Not Available |
| Gene Name | NPPB |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in hormone activity |
| Specific Function | Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3 (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 16 |
| Locus | Not Available |
| SNPs | NPPB |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 129 |
| Molecular Weight | 14113.0 |
| Theoretical pI | 8.25 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Natriuretic peptides B HPVGGPGPVSELPGLQELLDRLRDRVSELQAEQLRVEPLQQGQGLEETWDSPAAAPAGFL GPHHSILRALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | P13204 |
| UniProtKB/Swiss-Prot Entry Name | ANFB_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | DAAA02042958 |
| GeneCard ID | NPPB |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |