| Identification |
|---|
| BMDB Protein ID
| BMDBP02156 |
| Secondary Accession Numbers
| None |
| Name
| Multifunctional fusion protein |
| Synonyms
|
Not Available
|
| Gene Name
| IL1B |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in cytokine activity |
| Specific Function
| Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
Not Available
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 11 |
| Locus
| 11q23-q24 |
| SNPs
| IL1B |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 113 |
| Molecular Weight
| 13246.0 |
| Theoretical pI
| 5.93 |
| Pfam Domain Function
|
Not Available |
| Signals
|
|
|
Transmembrane Regions
|
- 4-24
- 38-58
- 136-156
- 174-194
- 212-232
- 244-264
- 269-289
- 293-313
|
| Protein Sequence
|
>Interleukin 1-beta
VFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFV
FYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP
|
| External Links |
|---|
| GenBank ID Protein
| AAW21225.1 |
| UniProtKB/Swiss-Prot ID
| Q5MAC0 |
| UniProtKB/Swiss-Prot Entry Name
| Q5MAC0_BOVIN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AY851162 |
| GeneCard ID
| IL1B |
| GenAtlas ID
| Not Available |
| HGNC ID
| Not Available |
| References |
|---|
| General References
| Not Available |
