Showing Protein SEC14-like protein 2 (BMDBP02253)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02253 |
| Secondary Accession Numbers | None |
| Name | SEC14-like protein 2 |
| Synonyms | Not Available |
| Gene Name | SEC14L2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in lipid binding |
| Specific Function | Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 17 |
| Locus | Not Available |
| SNPs | SEC14L2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 403 |
| Molecular Weight | 46200.0 |
| Theoretical pI | 8.17 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>SEC14-like protein 2 MSGRVGDLSPKQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARNFNLQKSEAMLRKHV EFRKQKDIDNIMSWQPPEVVQQYLSGGMCGYDLEGSPIWYDIIGPLDAKGLLLSASKQDL FKTKMRDCELLLQECVRQTEKMGKKIEATTLIYDCEGLGLKHLWKPAVEAYGEFLCMFEE NYPETLKRLFIVKAPKLFPVAYNLVKPFLSEDTRKKIQVLGANWKEVLLKYISPDQLPVE YGGTMTDPDGNPKCKSKINYGGDIPKKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPG CVLRWQFMSDGSDIGFGIFLKTKVGERQRAGEMREVLPSQRYNAHLVPEDGSLTCSDPGI YVLRFDNTYSFIHAKKVSFTVEVLLPDKALEEKMQQLGAVTPK |
| External Links | |
| GenBank ID Protein | AAO31942.1 |
| UniProtKB/Swiss-Prot ID | P58875 |
| UniProtKB/Swiss-Prot Entry Name | S14L2_BOVIN |
| PDB IDs | |
| GenBank Gene ID | AF432353 |
| GeneCard ID | SEC14L2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |