Identification
BMDB Protein ID BMDBP02564
Secondary Accession Numbers None
Name ME3
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 29
Locus Not Available
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 80
Molecular Weight 8932.0
Theoretical pI 5.49
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Malic enzyme
HLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHEHPIIFA
LSNPTSKAECTAEKCYRVTE
GenBank ID Protein AAW21971.1
UniProtKB/Swiss-Prot ID Q5MAA9
UniProtKB/Swiss-Prot Entry Name Q5MAA9_BOVIN
PDB IDs Not Available
GenBank Gene ID AY856094
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available